Lineage for d1vhua_ (1vhu A:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 835119Fold c.50: Macro domain-like [52948] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest
  4. 835120Superfamily c.50.1: Macro domain-like [52949] (2 families) (S)
  5. 835147Family c.50.1.2: Macro domain [89724] (6 proteins)
    found in different proteins, including macro-H2a histone and the Appr-1"-p processing enzyme
  6. 835163Protein Hypothetical protein AF1521 [89725] (1 species)
    contains extra N-terminal strand
  7. 835164Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [89726] (4 PDB entries)
    Uniprot O28751
  8. 835165Domain d1vhua_: 1vhu A: [100703]
    structural genomics
    complexed with mes

Details for d1vhua_

PDB Entry: 1vhu (more details), 1.34 Å

PDB Description: crystal structure of a putative phosphoesterase
PDB Compounds: (A:) hypothetical protein af1521

SCOP Domain Sequences for d1vhua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vhua_ c.50.1.2 (A:) Hypothetical protein AF1521 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}
mevlfeakvgditlklaqgditqypakaivnaankrlehgggvayaiakacagdaglyte
iskkamreqfgrdyidhgevvvtpamnleergikyvfhtvgpicsgmwseelkeklykaf
lgplekaeemgvesiafpavsagiygcdlekvvetfleavknfkgsavkevalviydrks
aevalkvfersl

SCOP Domain Coordinates for d1vhua_:

Click to download the PDB-style file with coordinates for d1vhua_.
(The format of our PDB-style files is described here.)

Timeline for d1vhua_: