![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.50: Macro domain-like [52948] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest |
![]() | Superfamily c.50.1: Macro domain-like [52949] (4 families) ![]() |
![]() | Family c.50.1.2: Macro domain [89724] (7 proteins) found in different proteins, including macro-H2a histone and the Appr-1"-p processing enzyme |
![]() | Protein Hypothetical protein AF1521 [89725] (1 species) contains extra N-terminal strand |
![]() | Species Archaeoglobus fulgidus [TaxId:2234] [89726] (4 PDB entries) Uniprot O28751 |
![]() | Domain d1vhua_: 1vhu A: [100703] structural genomics complexed with mes |
PDB Entry: 1vhu (more details), 1.34 Å
SCOPe Domain Sequences for d1vhua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vhua_ c.50.1.2 (A:) Hypothetical protein AF1521 {Archaeoglobus fulgidus [TaxId: 2234]} mevlfeakvgditlklaqgditqypakaivnaankrlehgggvayaiakacagdaglyte iskkamreqfgrdyidhgevvvtpamnleergikyvfhtvgpicsgmwseelkeklykaf lgplekaeemgvesiafpavsagiygcdlekvvetfleavknfkgsavkevalviydrks aevalkvfersl
Timeline for d1vhua_: