PDB entry 9pap

View 9pap on RCSB PDB site
Description: structure of papain refined at 1.65 angstroms resolution
Class: hydrolase (sulfhydryl proteinase)
Keywords: hydrolase (sulfhydryl proteinase)
Deposited on 1986-03-31, released 1986-10-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: papain
    Species: Carica papaya [TaxId:3649]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00784 (0-211)
      • conflict (46)
      • conflict (117)
      • conflict (134)
    Domains in SCOPe 2.07: d9papa_
  • Heterogens: MOH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >9papA (A:)
ipeyvdwrqkgavtpvknqgscgscwafsavvtiegiikirtgnlnqyseqelldcdrrs
ygcnggypwsalqlvaqygihyrntypyegvqrycrsrekgpyaaktdgvrqvqpynqga
llysianqpvsvvlqaagkdfqlyrggifvgpcgnkvdhavaavgygpnyiliknswgtg
wgengyirikrgtgnsygvcglytssfypvkn