PDB entry 9mht

View 9mht on RCSB PDB site
Description: cytosine-specific methyltransferase hhai/DNA complex
Class: transferase/DNA
Keywords: transferase, methyltransferase, restriction system, complex (methyltransferase/ DNA), transferase/DNA complex
Deposited on 1998-08-07, released 1998-11-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.39 Å
R-factor: 0.186
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytosine-specific methyltransferase hhai
    Species: Haemophilus haemolyticus [TaxId:726]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d9mhta_
  • Chain 'C':
    Compound: 5'-d(p*cp*cp*ap*tp*gp*cp*gp*cp*tp*gp*ap*c)-3'
  • Chain 'D':
    Compound: 5'-d(p*gp*tp*cp*ap*gp*(3dr)p*gp*cp*ap*tp*gp*g)-3'
  • Heterogens: SAH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >9mhtA (A:)
    mieikdkqltglrfidlfaglggfrlalescgaecvysnewdkyaqevyemnfgekpegd
    itqvnektipdhdilcagfpcqafsisgkqkgfedsrgtlffdiarivrekkpkvvfmen
    vknfashdngntlevvkntmneldysfhakvlnaldygipqkreriymicfrndlniqnf
    qfpkpfelntfvkdlllpdsevehlvidrkdlvmtnqeieqttpktvrlgivgkggqger
    iystrgiaitlsaygggifaktggylvngktrklhprecarvmgypdsykvhpstsqayk
    qfgnsvvinvlqyiaynigsslnfkpy
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.