PDB entry 8i1b

View 8i1b on RCSB PDB site
Description: a comparison of the high resolution structures of human and murine interleukin-1b
Deposited on 1991-01-29, released 1992-07-15
The last revision prior to the SCOP 1.63 freeze date was dated 1994-10-15, with a file datestamp of 1994-10-26.
Experiment type: -
Resolution: 2.4 Å
R-factor: 0.159
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.63: d8i1b__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >8i1b_ (-)
qlhyrlrdeqqkslvlsdpyelkalhlngqninqqvifsmsfvqgepsndkipvalglkg
knlylscvmkdgtptlqlesvdpkqypkkkmekrfvfnkievkskvefesaefpnwyist
sqaehkpvflgnnsgqdiidftmesv