PDB entry 7mns

View 7mns on RCSB PDB site
Description: Crystal Structure of the ZnF4 of Nucleoporin NUP358/RanBP2 in complex with Ran-GDP
Class: transport protein
Keywords: nuclear pore complex component, nucleocytoplasmic transport, transport protein, zinc finger
Deposited on 2021-05-01, released 2022-06-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2022-06-22, with a file datestamp of 2022-06-17.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: GTP-binding nuclear protein ran
  Species: Homo sapiens [TaxId:9606]
  Gene: RAN, ARA24, OK/SW-cl.81
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62826 (20-235)
    • expression tag (0-19)
    • engineered mutation (54)
• Chain 'B':
  Compound: E3 SUMO-protein ligase RanBP2
  Species: Homo sapiens [TaxId:9606]
  Gene: RANBP2, NUP358
  Database cross-references and differences (RAF-indexed):
  • Uniprot P49792 (6-42)
    • expression tag (0-5)
  Domains in SCOPe 2.08: d7mnsb1, d7mnsb2
• Heterogens: GDP, MG, ZN, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >7mnsB (B:)
  gplgsmgfedmfakkegqwdcssclvrneanatrcvacqnpdk
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >7mnsB (B:)
  mgfedmfakkegqwdcssclvrneanatrcvacqnpdk