SCOPe 2.08: Domain d7mnsb1: 7mns B:1535-1571

Lineage for d7mnsb1 (7mns B:1535-1571)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.11: Ran binding protein zinc finger-like [90209] (2 families)
   contains CxxxxC-x(n)-CxxC zinc-binding site; similar to the Sec23/24 zinc finger domain

5. Family g.41.11.0: automated matches [276056] (1 protein)
   not a true family

6. Protein automated matches [276057] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [276058] (2 PDB entries)

8. Domain d7mnsb1: 7mns B:1535-1571 [422768]
   Other proteins in same PDB: d7mnsb2
   automated match to d3ch5b_
   complexed with gdp, mg, zn

Details for d7mnsb1

PDB Entry: 7mns, 2.1 Å

PDB Description: crystal structure of the znf4 of nucleoporin nup358/ranbp2 in complex with ran-gdp

PDB Compounds: (B:) E3 SUMO-protein ligase RanBP2

SCOPe Domain Sequences for d7mnsb1:

Sequence; same for both SEQRES and ATOM records:

>d7mnsb1 g.41.11.0 (B:1535-1571) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gfedmfakkegqwdcssclvrneanatrcvacqnpdk

Timeline for d7mnsb1:

• d7mnsb1 is new in SCOPe 2.08-stable