PDB entry 7lm2

View 7lm2 on RCSB PDB site
Description: human pi3kdelta in complex with compound 3c
Class: transferase/transferase inhibitor
Keywords: pi3kdelta kinase, transferase, transferase-transferase inhibitor complex
Deposited on 2021-02-05, released 2021-04-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2021-05-05, with a file datestamp of 2021-04-30.
Experiment type: XRAY
Resolution: 2.79 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform
    Species: Homo sapiens [TaxId:9606]
    Gene: Pik3cd
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Phosphatidylinositol 3-kinase regulatory subunit alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: PIK3R1, GRB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27986 (0-168)
      • conflict (38)
      • conflict (88)
      • conflict (98)
      • conflict (108)
    Domains in SCOPe 2.07: d7lm2b_
  • Heterogens: Y5Y, EDO, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >7lm2B (B:)
    yqqdqvvkednieavgkklheyntqfqeksreydrlyedytrtsqeiqmkrtaieafnet
    ikifeeqcqtqeryskeyiekfkregneteiqrimhnyeklksriseivdsrrrleedlk
    kqaaeyreidkrmnsikpdliqlrktrdqylmwltqkgvrqkklnewlg