PDB entry 7l61

View 7l61 on RCSB PDB site
Description: C-type carbohydrate-recognition domain 4 of the mannose receptor complexed with L-fucose-(alpha 1-2)-D-galactose-(beta1-4)-D-glucose
Class: sugar binding protein
Keywords: glycobiology, carbohydrate-binding protein, c-type lectin, complex, sugar binding protein
Deposited on 2020-12-23, released 2021-02-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2021-02-17, with a file datestamp of 2021-02-12.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: N/A
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Macrophage mannose receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: MRC1, CLEC13D, CLEC13DL, MRC1L1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d7l61a_
  • Heterogens: CA, FUC, GAL, BGC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >7l61A (A:)
acpedwgassrtslcfklyakgkhekktwfesrdfcralggdlasinnkeeqqtiwrlit
asgsyhklfwlgltygspsegftwsdgspvsyenwaygepnnyqnveycgelkgdptmsw
ndincehlnnwicqi

    Sequence, based on observed residues (ATOM records): (download) 
    >7l61A (A:)
lcfklyakgkhekktwfesrdfcralggdlasinnkeeqqtiwrlitasgsyhklfwlgl
tygspsegftwsdgspvsyenwaygepnnyqnveycgelkgdptmswndincehlnnwic
qi