PDB entry 7kby

View 7kby on RCSB PDB site
Description: Artificial Metalloproteins with Dinuclear Iron Centers
Class: metal binding protein
Keywords: Biotin binding Artificial Metalloprotein, METAL BINDING PROTEIN
Deposited on 2020-10-03, released 2021-02-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2021-02-24, with a file datestamp of 2021-02-19.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22629 (13-End)
      • expression tag (10-12)
      • engineered mutation (120)
      • engineered mutation (123)
    Domains in SCOPe 2.07: d7kbya1, d7kbya2
  • Heterogens: KM3, CYN, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >7kbyA (A:)
masmtggqqmgrdeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgry
dsapatdgsgtalgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanaw
astyvghdtftkvkpsaasidaakkagvnngnpldavqq

    Sequence, based on observed residues (ATOM records): (download) 
    >7kbyA (A:)
grdeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsg
talgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawastyvghdtf
tkvk