PDB entry 7e2s

View 7e2s on RCSB PDB site
Description: Synechocystis GUN4 in complex with biliverdin IXa
Class: signaling protein
Keywords: gun4, ligand binding protein, signaling protein
Deposited on 2021-02-07, released 2021-08-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-08-25, with a file datestamp of 2021-08-20.
Experiment type: XRAY
Resolution: 1.05 Å
R-factor: N/A
AEROSPACI score: 0.85 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ycf53-like protein
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Gene: sll0558
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7e2sa1, d7e2sa2
  • Heterogens: BLA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >7e2sA (A:)
msdnltelsqqlhdasekkqltaiaalaemgeggqgilldylaknvplekpvlavgnvyq
tlrnleqetittqlqrnyptgifplqsaqgidylplqealgsqdfetadeitrdklcela
gpgasqrqwlyftevekfpaldlhtinalwwlhsngnfgfsvqrrlwlasgkeftklwpk
igwksgnvwtrwpkgftwdlsapqghlpllnqlrgvrvaeslyrhpvwsqygw