Lineage for d7e2sa2 (7e2s A:83-233)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2738471Fold a.261: GUN4-like [140868] (1 superfamily)
    multihelical; open array, trapping inside an extended region before the C-terminal helix
  4. 2738472Superfamily a.261.1: GUN4-like [140869] (1 family) (S)
    automatically mapped to Pfam PF05419
  5. 2738473Family a.261.1.1: GUN4-like [140870] (2 proteins)
    Pfam PF05419
  6. 2738478Protein Mg-chelatase cofactor Gun4 [140871] (2 species)
    Ycf53-like protein sll0558
  7. 2738481Species Synechocystis sp. [TaxId:1111708] [273035] (5 PDB entries)
  8. 3085130Domain d7e2sa2: 7e2s A:83-233 [421447]
    Other proteins in same PDB: d7e2sa1
    automated match to d1y6ia2
    complexed with bla, gol

Details for d7e2sa2

PDB Entry: 7e2s (more details), 1.05 Å

PDB Description: synechocystis gun4 in complex with biliverdin ixa
PDB Compounds: (A:) Ycf53-like protein

SCOPe Domain Sequences for d7e2sa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7e2sa2 a.261.1.1 (A:83-233) Mg-chelatase cofactor Gun4 {Synechocystis sp. [TaxId: 1111708]}
fplqsaqgidylplqealgsqdfetadeitrdklcelagpgasqrqwlyftevekfpald
lhtinalwwlhsngnfgfsvqrrlwlasgkeftklwpkigwksgnvwtrwpkgftwdlsa
pqghlpllnqlrgvrvaeslyrhpvwsqygw

SCOPe Domain Coordinates for d7e2sa2:

Click to download the PDB-style file with coordinates for d7e2sa2.
(The format of our PDB-style files is described here.)

Timeline for d7e2sa2:

  • d7e2sa2 is new in SCOPe 2.08-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d7e2sa1