PDB entry 6ydk

View 6ydk on RCSB PDB site
Description: Substrate-free P146A variant of beta-phosphoglucomutase from Lactococcus lactis
Class: isomerase
Keywords: cis-trans proline isomerization, allomorphy, phosphoryl transfer, enzyme regulation, ISOMERASE
Deposited on 2020-03-20, released 2020-10-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-11-18, with a file datestamp of 2020-11-13.
Experiment type: XRAY
Resolution: 2.02 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-phosphoglucomutase
    Species: Lactococcus lactis subsp. lactis (strain IL1403) [TaxId:272623]
    Gene: pgmB, LL0429, L0001
    Database cross-references and differences (RAF-indexed):
    • Uniprot P71447 (0-220)
      • engineered mutation (124)
      • engineered mutation (145)
      • engineered mutation (205)
    Domains in SCOPe 2.07: d6ydka_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6ydkA (A:)
mfkavlfdldgvitdtaeyhfrawkalaeeigingvdrqfneqlkgvsredslqkildla
dkkvsaeefkelakrkndnyvkmiqdvspadvypgilqllkdlrsnkikialasaskngp
fllermnltgyfdaiadpaevaaskaapdifiaaahavgvapsesigledsqagiqaikd
sgalpigvgrpedlgddivivpdtshytleflkevwlqkqk