PDB entry 6y94

View 6y94 on RCSB PDB site
Description: Ca2+-bound Calmodulin mutant N53I
Class: metal binding protein
Keywords: Mutant, metal-binding, signaling protein, CPVT, METAL BINDING PROTEIN
Deposited on 2020-03-06, released 2020-04-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-04-29, with a file datestamp of 2020-04-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: calmodulin
  Species: Homo sapiens [TaxId:9606]
  Gene: Calm1, Calm, Cam, Cam1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0DP23 (0-147)
    • engineered mutation (52)
  Domains in SCOPe 2.07: d6y94a_
• Heterogens: CA

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6y94A (A:)
  adqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdmiievdadgn
  gtidfpefltmmarkmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdee
  vdemireadidgdgqvnyeefvqmmtak