PDB entry 6x5x

View 6x5x on RCSB PDB site
Description: Crystal structure o BmooMP-I, a P-I metalloproteinase from Bothrops moojeni
Class: hydrolase
Keywords: Metalloproteinase P-I, Fibrinogenolytic metalloproteinase, HYDROLASE
Deposited on 2020-05-27, released 2020-10-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-10-07, with a file datestamp of 2020-10-02.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Snake venom metalloproteinase BmooMP-I
  Species: Bothrops moojeni [TaxId:98334]
  Database cross-references and differences (RAF-indexed):
  • PDB 6X5X (0-199)
  Domains in SCOPe 2.07: d6x5xa_
• Heterogens: ZN, CA, PG4, SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6x5xA (A:)
  afspryielavvadngmftkynsnlntirtrvhemvntvngfyssvnanaslanlqvwsi
  kdlikvekdsnktltsfgewrerdllprishdhaqllttivfdnyvigrsrsgkmcdpeq
  svgvvrdhsknnlwvavtmahelghnldmhhddtcscgakscimasvlsktksyafstcs
  qneyqtfltkhnpqcilnep