SCOPe 2.07: Structural Classification of Proteins

PDB entry 6wlp

View 6wlp on RCSB PDB site
Description: Crystal Structure of the ZTL light-state mimic G46S
Class: circadian clock protein, plant protein
Keywords: Circadian clock control, dimer, PLANT PROTEIN, CIRCADIAN CLOCK PROTEIN
Deposited on 2020-04-20, released 2021-03-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2021-03-03, with a file datestamp of 2021-02-26.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Adagio protein 1
Species: Arabidopsis thaliana [TaxId:3702]
Gene: ADO1, FKL2, LKP1, ZTL, At5g57360, MSF19.2
Database cross-references and differences (RAF-indexed):
- Uniprot Q94BT6
  - engineered mutation (45)
  - engineered mutation (79)
Domains in SCOPe 2.07: d6wlpa_
Chain 'B':
Compound: Adagio protein 1
Species: Arabidopsis thaliana [TaxId:3702]
Gene: ADO1, FKL2, LKP1, ZTL, At5g57360, MSF19.2
Database cross-references and differences (RAF-indexed):
- Uniprot Q94BT6
  - engineered mutation (45)
  - engineered mutation (79)
Domains in SCOPe 2.07: d6wlpb_
Chain 'C':
Compound: Adagio protein 1
Species: Arabidopsis thaliana [TaxId:3702]
Gene: ADO1, FKL2, LKP1, ZTL, At5g57360, MSF19.2
Database cross-references and differences (RAF-indexed):
- Uniprot Q94BT6
  - engineered mutation (45)
  - engineered mutation (79)
Domains in SCOPe 2.07: d6wlpc_
Chain 'D':
Compound: Adagio protein 1
Species: Arabidopsis thaliana [TaxId:3702]
Gene: ADO1, FKL2, LKP1, ZTL, At5g57360, MSF19.2
Database cross-references and differences (RAF-indexed):
- Uniprot Q94BT6
  - engineered mutation (45)
  - engineered mutation (79)
Domains in SCOPe 2.07: d6wlpd_
Chain 'E':
Compound: Adagio protein 1
Species: Arabidopsis thaliana [TaxId:3702]
Gene: ADO1, FKL2, LKP1, ZTL, At5g57360, MSF19.2
Database cross-references and differences (RAF-indexed):
- Uniprot Q94BT6
  - engineered mutation (45)
  - engineered mutation (79)
Domains in SCOPe 2.07: d6wlpe_
Chain 'F':
Compound: Adagio protein 1
Species: Arabidopsis thaliana [TaxId:3702]
Gene: ADO1, FKL2, LKP1, ZTL, At5g57360, MSF19.2
Database cross-references and differences (RAF-indexed):
- Uniprot Q94BT6
  - engineered mutation (45)
  - engineered mutation (79)
Domains in SCOPe 2.07: d6wlpf_
Chain 'G':
Compound: Adagio protein 1
Species: Arabidopsis thaliana [TaxId:3702]
Gene: ADO1, FKL2, LKP1, ZTL, At5g57360, MSF19.2
Database cross-references and differences (RAF-indexed):
- Uniprot Q94BT6
  - engineered mutation (45)
  - engineered mutation (79)
Domains in SCOPe 2.07: d6wlpg_
Heterogens: FMN, EDO, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>6wlpA (A:)
mewdsgsdlsaddassladdeegglfpgggpipypvgnllhtapcsfvvtdavepdqpii
yvntvfemvtgyraeevlgrncrflqcrgpfakrrhplvdsmvvseirkcidegiefqge
llnfrkdgsplmnrlrltpiygdddtithiigiqffietdidlgpvlgsstkeksidgiy
salaagernv