PDB entry 6vnz

View 6vnz on RCSB PDB site
Description: NMR solution structure of tamapin, mutant K20A
Class: toxin
Keywords: Tamapin mutant, CSalpha/beta, SK channels, TOXIN
Deposited on 2020-01-29, released 2020-07-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-09-09, with a file datestamp of 2020-09-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Potassium channel toxin alpha-KTx 5.4
    Species: Hottentotta tamulus [TaxId:34647]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P59869 (0-30)
      • engineered mutation (19)
    Domains in SCOPe 2.07: d6vnza_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6vnzA (A:)
    afcnlrrcelscrslgllgacigeeckcvpy