PDB entry 6vlp

View 6vlp on RCSB PDB site
Description: Hop phytocystatin in space group C2221
Class: protein binding
Keywords: cystatin, domain-swap, inhibitor, hop, PROTEIN BINDING
Deposited on 2020-01-24, released 2020-10-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-10-14, with a file datestamp of 2020-10-09.
Experiment type: XRAY
Resolution: 1.68 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hop1
    Species: Humulus lupulus [TaxId:3486]
    Database cross-references and differences (RAF-indexed):
    • PDB 6VLP
    Domains in SCOPe 2.07: d6vlpa_
  • Heterogens: TAM, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6vlpA (A:)
matvggikevdgnqnsleieslaryavdehnkkqnsllqfekvvntkqqvvsgtiyiitl
eavdggkkkvyeakvwekpwmnfkelqefkligdapsgssa

    Sequence, based on observed residues (ATOM records): (download) 
    >6vlpA (A:)
eieslaryavdehnkkqnsllqfekvvntkqqvvsgtiyiitleavdggkkkvyeakvwe
kpwmnfkelqefkligdaps