PDB entry 6url

View 6url on RCSB PDB site
Description: Barrier-to-autointegration factor soaked in isopropanol: 1 of 14 in MSCS set
Class: DNA binding protein
Keywords: alpha helical, MSCS, minor groove binder, DNA BINDING PROTEIN
Deposited on 2019-10-23, released 2020-10-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-10-21, with a file datestamp of 2020-10-16.
Experiment type: XRAY
Resolution: 1.72 Å
R-factor: N/A
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: barrier-to-autointegration factor
    Species: Homo sapiens [TaxId:9606]
    Gene: BANF1, BAF, BCRG1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6urla_
  • Chain 'B':
    Compound: barrier-to-autointegration factor
    Species: Homo sapiens [TaxId:9606]
    Gene: BANF1, BAF, BCRG1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6urlb_
  • Heterogens: EOH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6urlA (A:)
    mttsqkhrdfvaepmgekpvgslagigevlgkkleergfdkayvvlgqflvlkkdedlfr
    ewlkdtcganakqsrdcfgclrewcdafl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6urlB (B:)
    mttsqkhrdfvaepmgekpvgslagigevlgkkleergfdkayvvlgqflvlkkdedlfr
    ewlkdtcganakqsrdcfgclrewcdafl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6urlB (B:)
    ttsqkhrdfvaepmgekpvgslagigevlgkkleergfdkayvvlgqflvlkkdedlfre
    wlkdtcganakqsrdcfgclrewcdafl