PDB entry 6u97

View 6u97 on RCSB PDB site
Description: Structure of OmcF_H47I mutant
Class: electron transport
Keywords: OmcF, redox-Bohr effect, ELECTRON TRANSPORT
Deposited on 2019-09-06, released 2020-02-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-19, with a file datestamp of 2020-02-14.
Experiment type: XRAY
Resolution: 1.13 Å
R-factor: N/A
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lipoprotein cytochrome c, 1 heme-binding site
    Species: Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) [TaxId:243231]
    Gene: omcF, GSU2432
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q74AE4 (1-81)
      • expression tag (0)
      • engineered mutation (24)
    Domains in SCOPe 2.08: d6u97a1, d6u97a2
  • Heterogens: HEM, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6u97A (A:)
agagggelfathcagchpqggntvipektlararreangirtvrdvaayirnpgpgmpaf
geamippadalkigeyvvasfp