SCOPe 2.08: Domain d6u97a1: 6u97 A:24-104

Lineage for d6u97a1 (6u97 A:24-104)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.0: automated matches [191374] (1 protein)
   not a true family

6. Protein automated matches [190453] (26 species)
   not a true protein

7. Species Geobacter sulfurreducens [TaxId:243231] [226497] (6 PDB entries)

8. Domain d6u97a1: 6u97 A:24-104 [381239]
   Other proteins in same PDB: d6u97a2
   automated match to d5mcsa_
   complexed with hem, so4; mutant

Details for d6u97a1

PDB Entry: 6u97, 1.13 Å

PDB Description: structure of omcf_h47i mutant

PDB Compounds: (A:) Lipoprotein cytochrome c, 1 heme-binding site

SCOPe Domain Sequences for d6u97a1:

Sequence; same for both SEQRES and ATOM records:

>d6u97a1 a.3.1.0 (A:24-104) automated matches {Geobacter sulfurreducens [TaxId: 243231]}
gagggelfathcagchpqggntvipektlararreangirtvrdvaayirnpgpgmpafg
eamippadalkigeyvvasfp

Timeline for d6u97a1:

• d6u97a1 first appeared in SCOPe 2.07