PDB entry 6t71

View 6t71 on RCSB PDB site
Description: 3C-like protease from Southampton virus complexed with XST00000375b.
Class: hydrolase
Keywords: Viral protease., HYDROLASE
Deposited on 2019-10-20, released 2020-08-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-08-19, with a file datestamp of 2020-08-14.
Experiment type: XRAY
Resolution: 1.52 Å
R-factor: N/A
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Genome polyprotein
    Species: Southampton virus (serotype 3) [TaxId:37129]
    Gene: ORF1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6t71a_
  • Chain 'B':
    Compound: Genome polyprotein
    Species: Southampton virus (serotype 3) [TaxId:37129]
    Gene: ORF1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6t71b_
  • Heterogens: MQB, DMS, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6t71A (A:)
apptlwsrvtkfgsgwgfwvsptvfittthviptsakeffgepltsiaihrageftlfrf
skkirpdltgmileegcpegtvcsvlikrdsgellplavrmgaiasmriqgrlvhgqsgm
lltganakgmdlgtipgdcgapyvykrandwvvcgvhaaatksgntvvcavq

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6t71B (B:)
ptlwsrvtkfgsgwgfwvsptvfittthviptsakeffgepltsiaihrageftlfrfsk
kirpdltgmileegcpegtvcsvlikrdsgellplavrmgaiasmriqgrlvhgqsgmll
tganakgmdlgtipgdcgapyvykrandwvvcgvhaaatksgntvvcavqa