PDB entry 6t4u

View 6t4u on RCSB PDB site
Description: ROR(gamma)t ligand binding domain in complex with 20-alpha-hydroxycholesterol and allosteric ligand MRL871
Class: gene regulation
Keywords: Nuclear Receptor, Allosteric, Inverse Agonist, Inhibitor, GENE REGULATION
Deposited on 2019-10-15, released 2020-11-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-11-18, with a file datestamp of 2020-11-13.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RORC, NR1F3, RORG, RZRG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51449 (0-239)
      • conflict (187)
    Domains in SCOPe 2.07: d6t4ua_
  • Heterogens: HCD, 4F1, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6t4uA (A:)
    teiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhltea
    iqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkyggmel
    fralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqynle
    lafhhhlhkthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaafpplykelfs