PDB entry 6r8o

View 6r8o on RCSB PDB site
Description: Human Cyclophilin D in complex with 1-(((2R,3S,6R)-3-hydroxy-2,3,4,6-tetrahydro-1H-2,6-methanobenzo[c][1,5]oxazocin-8-yl)methyl)-3-(2-((R)-2-(2-(methylthio)phenyl)pyrrolidin-1-yl)-2-oxoethyl)urea
Class: isomerase
Keywords: cyclophilin, beta barrel, prolyl cis/trans isomerase, mitoc, isomerase
Deposited on 2019-04-02, released 2019-11-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-11-27, with a file datestamp of 2019-11-22.
Experiment type: XRAY
Resolution: 1.36 Å
R-factor: N/A
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Peptidyl-prolyl cis-trans isomerase F, mitochondrial
  Species: Homo sapiens [TaxId:9606]
  Gene: PPIF, CYP3
  Database cross-references and differences (RAF-indexed):
  • Uniprot P30405 (0-163)
    • engineered mutation (131)
  Domains in SCOPe 2.07: d6r8oa_
• Heterogens: PG4, SO4, PO4, JV2, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6r8oA (A:)
  gnplvyldvdangkplgrvvlelkadvvpktaenfralctgekgfgykgstfhrvipsfm
  cqagdftnhngtggksiygsrfpdenftlkhvgpgvlsmanagpntngsqffictiktdw
  ldgkhvvfghviegmdvvkkiesfgsksgrtskkivitdcgqls