PDB entry 6pyr

View 6pyr on RCSB PDB site
Description: Human PI3Kdelta in complex with Compound 2-10 ((3S)-3-benzyl-3-methyl-5-[5-(2-methylpyrimidin-5-yl)pyrazolo[1,5-a]pyrimidin-3-yl]-1,3-dihydro-2H-indol-2-one)
Class: transferase/transferase inhibitor
Keywords: PI3Kdelta kinase, transferase, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2019-07-30, released 2019-08-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-08-28, with a file datestamp of 2019-08-23.
Experiment type: XRAY
Resolution: 2.21 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform
  Species: Homo sapiens [TaxId:9606]
  Gene: Pik3cd
  Database cross-references and differences (RAF-indexed):
  • Uniprot O00329 (0-End)
• Chain 'B':
  Compound: Phosphatidylinositol 3-kinase regulatory subunit alpha
  Species: Homo sapiens [TaxId:9606]
  Gene: PIK3R1, GRB1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P27986 (0-168)
    • conflict (38)
    • conflict (88)
    • conflict (98)
    • conflict (108)
  Domains in SCOPe 2.07: d6pyrb_
• Heterogens: P5J, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >6pyrB (B:)
  yqqdqvvkednieavgkklheyntqfqeksreydrlyedytrtsqeiqmkrtaieafnet
  ikifeeqcqtqeryskeyiekfkregneteiqrimhnyeklksriseivdsrrrleedlk
  kqaaeyreidkrmnsikpdliqlrktrdqylmwltqkgvrqkklnewlg
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >6pyrB (B:)
  yqednieavgkklheyntqfqeksreydrlyedytrtsqeiqmkrtaieafnetikifee
  qcqtqeryskeyiekfkregneteiqrimhnyeklksriseivdsrrrleedlkkqaaey
  reidkrmnsikpdliqlrktrdqylmwltqkgvrqkklnewlg