PDB entry 6puv

View 6puv on RCSB PDB site
Description: Structure of the CRD of CLEC10A
Class: signaling protein
Keywords: c-type lectin crd, signaling protein
Deposited on 2019-07-18, released 2020-07-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-07-22, with a file datestamp of 2020-07-17.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: N/A
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: C-type lectin domain family 10 member A
    Species: Homo sapiens [TaxId:9606]
    Gene: CLEC10A, CLECSF13, CLECSF14, HML
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8IUN9 (1-128)
      • expression tag (0)
    Domains in SCOPe 2.07: d6puva1, d6puva2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6puvA (A:)
scpvnwvehqdscywfshsgmswaeaekycqlknahlvvinsreeqnfvqkylgsaytwm
glsdpegawkwvdgtdyatgfqnwkpgqpddwqghglgggedcahfhpdgrwnddvcqrp
yhwvceagl

    Sequence, based on observed residues (ATOM records): (download) 
    >6puvA (A:)
scpvnwvehqdscywfshsgmswaeaekycqlknahlvvinsreeqnfvqkylgsaytwm
glsdpegawkwvdgtdyatgfqnwkpgqpddwedcahfhpdgrwnddvcqrpyhwvceag
l