PDB entry 6p0i

View 6p0i on RCSB PDB site
Description: Crystal structure of GDP-bound human RalA in a covalent complex with aryl sulfonyl fluoride compounds.
Class: signaling protein/inhibitor
Keywords: Ral GTPase, RalA, covalent inhibitor, sulfonyl fluoride, SIGNALING PROTEIN, signaling protein-inhibitor complex
Deposited on 2019-05-17, released 2020-03-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-04-15, with a file datestamp of 2020-04-10.
Experiment type: XRAY
Resolution: 1.18 Å
R-factor: N/A
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: Ras-related protein Ral-A
    Species: Homo sapiens [TaxId:9606]
    Gene: RALA, RAL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11233 (Start-177)
      • expression tag (178)
    Domains in SCOPe 2.08: d6p0ib1, d6p0ib2
  • Heterogens: NL7, GDP, EDO, ACT, GOL, CA, CL, NA, HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >6p0iB (B:)
maankpkgqnslalhkvimvgsggvgksaltlqfmydefvedyeptkadsyrkkvvldge
evqidildtagqedyaairdnyfrsgegflcvfsitemesfaatadfreqilrvkedenv
pfllvgnksdledkrqvsveeaknraeqwnvnyvetsaktranvdkvffdlmreirarle
hhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >6p0iB (B:)
slalhkvimvgsggvgksaltlqfmydefvedyeptkadsyrkkvvldgeevqidildta
gqedyaairdnyfrsgegflcvfsitemesfaatadfreqilrvkedenvpfllvgnksd
ledkrqvsveeaknraeqwnvnyvetsaktranvdkvffdlmreirarl