Lineage for d6p0ib1 (6p0i B:11-178)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2872051Species Human (Homo sapiens) [TaxId:9606] [186862] (207 PDB entries)
  8. 2872054Domain d6p0ib1: 6p0i B:11-178 [381774]
    Other proteins in same PDB: d6p0ib2
    automated match to d2kwia_
    complexed with act, ca, cl, edo, gdp, gol, na, nl7

Details for d6p0ib1

PDB Entry: 6p0i (more details), 1.18 Å

PDB Description: crystal structure of gdp-bound human rala in a covalent complex with aryl sulfonyl fluoride compounds.
PDB Compounds: (B:) Ras-related protein Ral-A

SCOPe Domain Sequences for d6p0ib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6p0ib1 c.37.1.0 (B:11-178) automated matches {Human (Homo sapiens) [TaxId: 9606]}
slalhkvimvgsggvgksaltlqfmydefvedyeptkadsyrkkvvldgeevqidildta
gqedyaairdnyfrsgegflcvfsitemesfaatadfreqilrvkedenvpfllvgnksd
ledkrqvsveeaknraeqwnvnyvetsaktranvdkvffdlmreirar

SCOPe Domain Coordinates for d6p0ib1:

Click to download the PDB-style file with coordinates for d6p0ib1.
(The format of our PDB-style files is described here.)

Timeline for d6p0ib1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6p0ib2