PDB entry 6oml

View 6oml on RCSB PDB site
Description: Human BMP chimera BV261
Class: cytokine
Keywords: BMP, bone morphogenetic protein, CYTOKINE
Deposited on 2019-04-18, released 2019-05-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-15, with a file datestamp of 2019-05-10.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Bone morphogenetic protein 2 and Bone morphogenetic protein 6
    Species: Homo sapiens [TaxId:9606]
    Gene: BMP2, BMP2A
    Database cross-references and differences (RAF-indexed):
    • PDB 6OML (0-104)
    Domains in SCOPe 2.07: d6omlx_
  • Chain 'Y':
    Compound: Bone morphogenetic protein 2 and Bone morphogenetic protein 6
    Species: Homo sapiens [TaxId:9606]
    Gene: BMP2, BMP2A
    Database cross-references and differences (RAF-indexed):
    • PDB 6OML (0-104)
    Domains in SCOPe 2.07: d6omly_
  • Heterogens: NAG, BMA, MAN, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6omlX (X:)
kssckrhplyvdfsdvgwndwivappgyhafycdgecsfplnahmnatnhaivqtlvhlm
npeyvpkpccaptelsaismlyldenekvvlknyqdmvvegcgcr

  • Chain 'Y':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6omlY (Y:)
kssckrhplyvdfsdvgwndwivappgyhafycdgecsfplnahmnatnhaivqtlvhlm
npeyvpkpccaptelsaismlyldenekvvlknyqdmvvegcgcr