PDB entry 6oco

View 6oco on RCSB PDB site
Description: human pi3kdelta in complex with compound 6
Class: transferase/transferase inhibitor
Keywords: PI3KDELTA KINASE, TRANSFERASE, transferase-transferase inhibitor complex
Deposited on 2019-03-25, released 2019-12-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-12-11, with a file datestamp of 2019-12-06.
Experiment type: XRAY
Resolution: 2.58 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform
  Species: Homo sapiens [TaxId:9606]
  Gene: Pik3cd
  Database cross-references and differences (RAF-indexed):
  • Uniprot O00329 (0-1014)
• Chain 'B':
  Compound: Phosphatidylinositol 3-kinase regulatory subunit alpha
  Species: Bos taurus [TaxId:9913]
  Gene: PIK3R1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P23727 (0-169)
  Domains in SCOPe 2.07: d6ocob_
• Heterogens: M5V, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6ocoB (B:)
  yqqdqvvkednieavgkklheyntqfqeksreydrlyedytrtsqeiqmkrtaieafnet
  ikifeeqcqtqeryskeyiekfkregneteiqrimhnyeklksriseivdsrrrleedlk
  kqaaeyreidkrmnsikpdliqlrktrdqylmwltqkgvrqkklnewlgn