PDB entry 6obe

View 6obe on RCSB PDB site
Description: Ricin A chain bound to VHH antibody V6H8
Class: toxin
Keywords: toxin
Deposited on 2019-03-20, released 2020-04-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-04-01, with a file datestamp of 2020-03-27.
Experiment type: XRAY
Resolution: 1.73 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ricin a chain
    Species: Ricinus communis [TaxId:3988]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6obea_
  • Chain 'B':
    Compound: VHH antibody V6H8
    Species: VICUGNA PACOS [TaxId:30538]
    Database cross-references and differences (RAF-indexed):
    • PDB 6OBE (0-117)
  • Heterogens: NI, EDO, IMD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6obeA (A:)
pkqypiinfttagatvqsytnfiravrgrlttgadvrheipvlpnrvglpinqrfilvel
snhaelsvtlaldvtnayvvgyragnsayffhpdnqedaeaithlftdvqnrytfafggn
ydrleqlagnlrenielgngpleeaisalyyystggtqlptlarsfiiciqmiseaarfq
yiegemrtrirynrrsapdpsvitlenswgrlstaiqesnqgafaspiqlqrrngskfsv
ydvsilipiialmvyrcapppssqf

  • Chain 'B':
    No sequence available.