PDB entry 6nlv

View 6nlv on RCSB PDB site
Description: Selective inhibition of carbonic anhydrase IX activity, using compound SLC-149, displays limited anticancer effects in breast cancer cell lines
Class: lyase/lyase inhibitor
Keywords: breast cancer, hypoxia, LYASE, LYASE-LYASE INHIBITOR complex
Deposited on 2019-01-09, released 2020-01-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-01-15, with a file datestamp of 2020-01-10.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Carbonic anhydrase 2
  Species: Homo sapiens [TaxId:9606]
  Gene: CA2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00918 (0-256)
    • engineered mutation (61)
    • engineered mutation (63)
    • engineered mutation (65)
    • engineered mutation (87)
    • engineered mutation (126)
    • engineered mutation (165)
    • engineered mutation (199)
  Domains in SCOPe 2.07: d6nlva_
• Heterogens: KRY, ZN, DMS, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6nlvA (A:)
  hwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnng
  hsfqvtfddsqdkavlkggpldgtyrllqfhfhwgsldgqgsehtvdkkkyaaelhlvhw
  ntkygdvgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktegksadftnfdprgl
  lpesldywtypgslttpplaecvtwivlkepisvsseqvlkfrklnfngegepeelmvdn
  wrpaqplknrqikasfk