PDB entry 6mht

View 6mht on RCSB PDB site
Description: ternary structure of hhai methyltransferase with adohcy and DNA containing 4'-thio-2'deoxycytidine at the target
Class: transferase/DNA
Keywords: transferase, methyltransferase, restriction system, complex (methyltransferase/DNA)
Deposited on 1998-08-05, released 1998-08-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.186
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytosine-specific methyltransferase hhai
    Species: Haemophilus haemolyticus [TaxId:726]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6mhta_
  • Chain 'C':
    Compound: DNA (5'-d(p*cp*cp*ap*tp*gp*(5cm)p*gp*cp*tp*gp*ap*c)-3')
    Species: Haemophilus haemolyticus [TaxId:726]
  • Chain 'D':
    Compound: DNA (5'-d(p*gp*tp*cp*ap*gp*(4sc)p*gp*cp*ap*tp*gp*g)-3')
  • Heterogens: SAM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6mhtA (A:)
    mieikdkqltglrfidlfaglggfrlalescgaecvysnewdkyaqevyemnfgekpegd
    itqvnektipdhdilcagfpcqafsisgkqkgfedsrgtlffdiarivrekkpkvvfmen
    vknfashdngntlevvkntmneldysfhakvlnaldygipqkreriymicfrndlniqnf
    qfpkpfelntfvkdlllpdsevehlvidrkdlvmtnqeieqttpktvrlgivgkggqger
    iystrgiaitlsaygggifaktggylvngktrklhprecarvmgypdsykvhpstsqayk
    qfgnsvvinvlqyiaynigsslnfkpy
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.