PDB entry 6ipo

View 6ipo on RCSB PDB site
Description: Ferritin mutant C90A/C102A/C130A/D144C
Class: oxidoreductase
Keywords: Ferritin, Disulfide bond, 48-mer nanocage, OXIDOREDUCTASE
Deposited on 2018-11-03, released 2019-03-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-13, with a file datestamp of 2019-03-08.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ferritin heavy chain
  Species: Homo sapiens [TaxId:9606]
  Gene: FTH1, FTH, FTHL6, OK/SW-cl.84, PIG15
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02794
    • engineered mutation (89)
    • engineered mutation (101)
    • engineered mutation (129)
    • engineered mutation (143)
  Domains in SCOPe 2.07: d6ipoa_
• Chain 'B':
  Compound: ferritin heavy chain
  Species: Homo sapiens [TaxId:9606]
  Gene: FTH1, FTH, FTHL6, OK/SW-cl.84, PIG15
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02794
    • engineered mutation (89)
    • engineered mutation (101)
    • engineered mutation (129)
    • engineered mutation (143)
• Heterogens: MG, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >6ipoA (A:)
  ttastsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsh
  eerehaeklmklqnqrggriflqdikkpdaddwesglnameaalhleknvnqsllelhkl
  atdkndphladfiethylikelgchvtnlrkmgapesglaeylfdkhtlgdsdnes
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >6ipoA (A:)
  qnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheerehaekl
  mklqnqrggriflqdikkpdaddwesglnameaalhleknvnqsllelhklatdkndphl
  adfiethylikelgchvtnlrkmgapesglaeylfdkhtlgd
  

  
  
• Chain 'B':
  No sequence available.