PDB entry 6if9

View 6if9 on RCSB PDB site
Description: Solution-state NMR structure of G57W human gammaS crystallin
Class: recombination
Keywords: structure from cyana 3.97, recombination
Deposited on 2018-09-19, released 2019-04-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-04-10, with a file datestamp of 2019-04-05.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Gamma-crystallin S
    Species: Homo sapiens [TaxId:9606]
    Gene: CRYGS, CRYG8
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22914 (0-177)
      • engineered mutation (56)
    Domains in SCOPe 2.08: d6if9a1, d6if9a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6if9A (A:)
msktgtkitfyedknfqgrrydcdcdcadfhtylsrcnsikveggtwavyerpnfawymy
ilpqgeypeyqrwmglndrlsscravhlpsggqykiqifekgdfsgqmyettedcpsime
qfhmreihsckvlegvwifyelpnyrgrqylldkkeyrkpidwgaaspavqsfrrive