Lineage for d6if9a2 (6if9 A:92-178)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2773464Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
    duplication: has internal pseudo twofold symmetry
  4. 2773465Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) (S)
  5. 2773466Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (5 proteins)
  6. 2773579Protein automated matches [254533] (1 species)
    not a true protein
  7. 2773580Species Human (Homo sapiens) [TaxId:9606] [255181] (6 PDB entries)
  8. 2773594Domain d6if9a2: 6if9 A:92-178 [367480]
    automated match to d1zwma2

Details for d6if9a2

PDB Entry: 6if9 (more details)

PDB Description: solution-state nmr structure of g57w human gammas crystallin
PDB Compounds: (A:) Gamma-crystallin S

SCOPe Domain Sequences for d6if9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6if9a2 b.11.1.1 (A:92-178) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gqykiqifekgdfsgqmyettedcpsimeqfhmreihsckvlegvwifyelpnyrgrqyl
ldkkeyrkpidwgaaspavqsfrrive

SCOPe Domain Coordinates for d6if9a2:

Click to download the PDB-style file with coordinates for d6if9a2.
(The format of our PDB-style files is described here.)

Timeline for d6if9a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6if9a1