PDB entry 6hs9

View 6hs9 on RCSB PDB site
Description: The crystal structure of type II Dehydroquinase from Butyrivibrio crossotus DSM 2876
Class: biosynthetic protein
Keywords: shikimate pathway, dehydratase, BIOSYNTHETIC PROTEIN
Deposited on 2018-09-29, released 2019-10-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-10-23, with a file datestamp of 2019-10-18.
Experiment type: XRAY
Resolution: 1.05 Å
R-factor: N/A
AEROSPACI score: 0.78 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: 3-dehydroquinate dehydratase
  Species: Butyrivibrio crossotus DSM 2876 [TaxId:511680]
  Gene: aroQ, BUTYVIB_01550
  Database cross-references and differences (RAF-indexed):
  • Uniprot D4S0D1 (3-144)
    • expression tag (0-2)
  Domains in SCOPe 2.07: d6hs9a1, d6hs9a2
• Heterogens: 3DS, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6hs9A (A:)
  gshmkilvingpnlnflgirekniygnenyeylvnmineycksknievecyqsnhegaii
  dkiqeayfngtdgivinpgaythysyairdalasvshikkievhisnvnereefrhisvt
  epvcngqivgqglkgyimaidmlns