PDB entry 6hn7

View 6hn7 on RCSB PDB site
Description: Hijacking the Hijackers: Escherichia coli Pathogenicity Islands Redirect Helper Phage Packaging for Their Own Benefit.
Class: DNA binding protein
Keywords: Redirecting packaging protein, DNA Binding protein, Hetero-dimer, phage interference, Protein complex
Deposited on 2018-09-14, released 2019-07-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-31, with a file datestamp of 2019-07-26.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Redirecting phage packaging protein C (RppC)
    Species: Escherichia coli [TaxId:562]
    Gene: CXXR01000010.1
    Database cross-references and differences (RAF-indexed):
    • PDB 6HN7
  • Chain 'B':
    Compound: terminase small subunit
    Species: Escherichia phage lambda [TaxId:10710]
    Gene: Nu1, lambdap01
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03707 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d6hn7b1, d6hn7b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6hn7B (B:)
    aaamevnkkqladifgasirtiqnwqeqgmpvlrgggkgnevlydsaavikwyaerdaei
    eneklrreveelrqaseadlqpgtieyerhrltraqadaqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hn7B (B:)
    aaamevnkkqladifgasirtiqnwqeqgmpvlrgggkgnevlydsaavikwyaerdaei
    eneklrreveel