Lineage for d6hn7b1 (6hn7 B:1-69)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696351Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
    core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different
  4. 2696352Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families) (S)
  5. 2696440Family a.6.1.5: Terminase gpNU1 subunit domain [74696] (2 proteins)
    automatically mapped to Pfam PF07471
  6. 2696445Protein automated matches [372285] (1 species)
    not a true protein
  7. 2696446Species Escherichia phage [TaxId:10710] [372286] (1 PDB entry)
  8. 2696447Domain d6hn7b1: 6hn7 B:1-69 [372287]
    Other proteins in same PDB: d6hn7b2
    automated match to d1j9ia_
    protein/DNA complex

Details for d6hn7b1

PDB Entry: 6hn7 (more details), 3 Å

PDB Description: hijacking the hijackers: escherichia coli pathogenicity islands redirect helper phage packaging for their own benefit.
PDB Compounds: (B:) terminase small subunit

SCOPe Domain Sequences for d6hn7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hn7b1 a.6.1.5 (B:1-69) automated matches {Escherichia phage [TaxId: 10710]}
mevnkkqladifgasirtiqnwqeqgmpvlrgggkgnevlydsaavikwyaerdaeiene
klrreveel

SCOPe Domain Coordinates for d6hn7b1:

Click to download the PDB-style file with coordinates for d6hn7b1.
(The format of our PDB-style files is described here.)

Timeline for d6hn7b1: