PDB entry 6gl0

View 6gl0 on RCSB PDB site
Description: Structure of ZgEngAGH5_4 in complex with a cellotriose
Class: hydrolase
Keywords: Glycoside hydrolase, GH5, Mixed linked glucan, Zobellia galactanivorans, HYDROLASE
Deposited on 2018-05-22, released 2018-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-31, with a file datestamp of 2018-10-26.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endoglucanase, family GH5
    Species: Zobellia galactanivorans [TaxId:63186]
    Gene: engA, zobellia_208
    Database cross-references and differences (RAF-indexed):
    • Uniprot G0L8Z3 (1-330)
      • expression tag (0)
      • engineered mutation (268)
    Domains in SCOPe 2.07: d6gl0a1, d6gl0a2
  • Chain 'B':
    Compound: Endoglucanase, family GH5
    Species: Zobellia galactanivorans [TaxId:63186]
    Gene: engA, zobellia_208
    Database cross-references and differences (RAF-indexed):
    • Uniprot G0L8Z3 (1-330)
      • expression tag (0)
      • engineered mutation (268)
    Domains in SCOPe 2.07: d6gl0b1, d6gl0b2
  • Chain 'C':
    Compound: Endoglucanase, family GH5
    Species: Zobellia galactanivorans [TaxId:63186]
    Gene: engA, zobellia_208
    Database cross-references and differences (RAF-indexed):
    • Uniprot G0L8Z3 (1-330)
      • expression tag (0)
      • engineered mutation (268)
    Domains in SCOPe 2.07: d6gl0c1, d6gl0c2
  • Heterogens: GLC, BGC, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6gl0A (A:)
    snmreiapkefvldmgagwnlgnamdtynsdetawgnplttkamideiakmgfktlrlpv
    twkfhigegpdylieanwldkveaianfalenemyviinihhdetwilptyekadevkde
    lskvwtqianrfktygdylifetlneprhkgtpeewkggtqegrdavnqyhqvsvdaira
    tggnnakrkimvstyaastasnalndylvpngdknvivsvhsyfpyqfcldgtdstwgte
    adktallaeldkirdkfivednravvmgswgstfsdnpedrlahaefyaracaergicpi
    wwdngnvdefgifnrntlewnypeiaeaivk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6gl0B (B:)
    snmreiapkefvldmgagwnlgnamdtynsdetawgnplttkamideiakmgfktlrlpv
    twkfhigegpdylieanwldkveaianfalenemyviinihhdetwilptyekadevkde
    lskvwtqianrfktygdylifetlneprhkgtpeewkggtqegrdavnqyhqvsvdaira
    tggnnakrkimvstyaastasnalndylvpngdknvivsvhsyfpyqfcldgtdstwgte
    adktallaeldkirdkfivednravvmgswgstfsdnpedrlahaefyaracaergicpi
    wwdngnvdefgifnrntlewnypeiaeaivk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6gl0C (C:)
    snmreiapkefvldmgagwnlgnamdtynsdetawgnplttkamideiakmgfktlrlpv
    twkfhigegpdylieanwldkveaianfalenemyviinihhdetwilptyekadevkde
    lskvwtqianrfktygdylifetlneprhkgtpeewkggtqegrdavnqyhqvsvdaira
    tggnnakrkimvstyaastasnalndylvpngdknvivsvhsyfpyqfcldgtdstwgte
    adktallaeldkirdkfivednravvmgswgstfsdnpedrlahaefyaracaergicpi
    wwdngnvdefgifnrntlewnypeiaeaivk