Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
Protein automated matches [190075] (132 species) not a true protein |
Species Zobellia galactanivorans [TaxId:63186] [359583] (2 PDB entries) |
Domain d6gl0b1: 6gl0 B:56-385 [359591] Other proteins in same PDB: d6gl0a2, d6gl0b2, d6gl0c2 automated match to d3ndza_ complexed with mg |
PDB Entry: 6gl0 (more details), 2.2 Å
SCOPe Domain Sequences for d6gl0b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6gl0b1 c.1.8.0 (B:56-385) automated matches {Zobellia galactanivorans [TaxId: 63186]} nmreiapkefvldmgagwnlgnamdtynsdetawgnplttkamideiakmgfktlrlpvt wkfhigegpdylieanwldkveaianfalenemyviinihhdetwilptyekadevkdel skvwtqianrfktygdylifetlneprhkgtpeewkggtqegrdavnqyhqvsvdairat ggnnakrkimvstyaastasnalndylvpngdknvivsvhsyfpyqfcldgtdstwgtea dktallaeldkirdkfivednravvmgswgstfsdnpedrlahaefyaracaergicpiw wdngnvdefgifnrntlewnypeiaeaivk
Timeline for d6gl0b1:
View in 3D Domains from other chains: (mouse over for more information) d6gl0a1, d6gl0a2, d6gl0c1, d6gl0c2 |