Lineage for d6gl0b1 (6gl0 B:56-385)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2832343Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2832344Protein automated matches [190075] (132 species)
    not a true protein
  7. 2833348Species Zobellia galactanivorans [TaxId:63186] [359583] (2 PDB entries)
  8. 2833350Domain d6gl0b1: 6gl0 B:56-385 [359591]
    Other proteins in same PDB: d6gl0a2, d6gl0b2, d6gl0c2
    automated match to d3ndza_
    complexed with mg

Details for d6gl0b1

PDB Entry: 6gl0 (more details), 2.2 Å

PDB Description: structure of zgengagh5_4 in complex with a cellotriose
PDB Compounds: (B:) Endoglucanase, family GH5

SCOPe Domain Sequences for d6gl0b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gl0b1 c.1.8.0 (B:56-385) automated matches {Zobellia galactanivorans [TaxId: 63186]}
nmreiapkefvldmgagwnlgnamdtynsdetawgnplttkamideiakmgfktlrlpvt
wkfhigegpdylieanwldkveaianfalenemyviinihhdetwilptyekadevkdel
skvwtqianrfktygdylifetlneprhkgtpeewkggtqegrdavnqyhqvsvdairat
ggnnakrkimvstyaastasnalndylvpngdknvivsvhsyfpyqfcldgtdstwgtea
dktallaeldkirdkfivednravvmgswgstfsdnpedrlahaefyaracaergicpiw
wdngnvdefgifnrntlewnypeiaeaivk

SCOPe Domain Coordinates for d6gl0b1:

Click to download the PDB-style file with coordinates for d6gl0b1.
(The format of our PDB-style files is described here.)

Timeline for d6gl0b1: