PDB entry 6g9v

View 6g9v on RCSB PDB site
Description: Crystal structure of Aspergillus fumigatus UDP-N-acetylglucosamine pyrophosphorylase(AfUAP1) in complex with UDPGlcNAc, pyrophosphate and Mg2+
Class: transferase
Keywords: cell wall, anti fungal, pyrophosphorylase, Aspergillus fumigatus, Transferase
Deposited on 2018-04-11, released 2019-04-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-24, with a file datestamp of 2019-04-19.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: udp-n-acetylglucosamine pyrophosphorylase
    Species: Aspergillus fumigatus Af293 [TaxId:330879]
    Gene: AFUA_7G02180
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6g9va_
  • Chain 'B':
    Compound: udp-n-acetylglucosamine pyrophosphorylase
    Species: Aspergillus fumigatus Af293 [TaxId:330879]
    Gene: AFUA_7G02180
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6g9vb_
  • Heterogens: UD1, PPV, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6g9vA (A:)
    mavaiketvsnfmerfhghpenlprepsaeefqqlrkkytdagqghvfafvdelqtgers
    qlfhqlssfdpvrineladkalnppkaddgpasleplpdiatasildsdpkdleqwyeeg
    lklvagnkvavvlmaggqgtrlgssapkgcfdiglpshkslfqiqaeriaklqllaqris
    gkeavipwyvmtsgptrkpteeffeqhkyfglnksdviifeqgvlpcisnegkilmeskf
    kvavapdgnggiyqalltsgvredmrkrgiehihtycvdnclvkvadpvfigfaaskqvd
    iatkvvrkrnatesvglilqkngkpdvveyseidketaeakdpkqpdvlkfraanivnhy
    ysfkffesielwahklphhvarkkipcikegtgeffkpekpngikleqfvfdvfpmtple
    kfacievrredefsplknargtgeddpdtskrdimsqgqrwiekaggivitegdvvgvev
    splisyggegleflkgreikapafiekee
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g9vA (A:)
    psaeefqqlrkkytdagqghvfafvdelqtgersqlfhqlssfdpvrineladkalnppa
    sleplpdiatasildsdpkdleqwyeeglklvagnkvavvlmaggqgtrlgssapkgcfd
    iglpshkslfqiqaeriaklqllaqrisgkeavipwyvmtsgptrkpteeffeqhkyfgl
    nksdviifeqgvlpcisnegkilmeskfkvavapdgnggiyqalltsgvredmrkrgieh
    ihtycvdnclvkvadpvfigfaaskqvdiatkvvrkrnatesvglilqkngkpdvveyse
    idketaeakdpkqpdvlkfraanivnhyysfkffesielwahklphhvarkkipcipngi
    kleqfvfdvfpmtplekfacievrredefsplknargtgeddpdtskrdimsqgqrwiek
    aggivitegvgvevsplisyggegleflkgreikapafiek
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6g9vB (B:)
    mavaiketvsnfmerfhghpenlprepsaeefqqlrkkytdagqghvfafvdelqtgers
    qlfhqlssfdpvrineladkalnppkaddgpasleplpdiatasildsdpkdleqwyeeg
    lklvagnkvavvlmaggqgtrlgssapkgcfdiglpshkslfqiqaeriaklqllaqris
    gkeavipwyvmtsgptrkpteeffeqhkyfglnksdviifeqgvlpcisnegkilmeskf
    kvavapdgnggiyqalltsgvredmrkrgiehihtycvdnclvkvadpvfigfaaskqvd
    iatkvvrkrnatesvglilqkngkpdvveyseidketaeakdpkqpdvlkfraanivnhy
    ysfkffesielwahklphhvarkkipcikegtgeffkpekpngikleqfvfdvfpmtple
    kfacievrredefsplknargtgeddpdtskrdimsqgqrwiekaggivitegdvvgvev
    splisyggegleflkgreikapafiekee
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g9vB (B:)
    psaeefqqlrkkytdagqghvfafvdelqtgersqlfhqlssfdpvrineladkalnpps
    leplpdiatasildsdpkdleqwyeeglklvagnkvavvlmaggqgtrlgssapkgcfdi
    glpshkslfqiqaeriaklqllaqrisgkeavipwyvmtsgptrkpteeffeqhkyfgln
    ksdviifeqgvlpcisnegkilmeskfkvavapdgnggiyqalltsgvredmrkrgiehi
    htycvdnclvkvadpvfigfaaskqvdiatkvvrkrnatesvglilqkngkpdvveysei
    dketaeakdpkqpdvlkfraanivnhyysfkffesielwahklphhvarkkipcikepek
    pngikleqfvfdvfpmtplekfacievrredefsplknargtgeddpdtskrdimsqgqr
    wiekaggivitevgvevsplisyggegleflkgreikapafiek