Lineage for d6g9va_ (6g9v A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2898275Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2898276Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2899284Family c.68.1.0: automated matches [191551] (1 protein)
    not a true family
  6. 2899285Protein automated matches [190951] (34 species)
    not a true protein
  7. 2899302Species Aspergillus fumigatus [TaxId:330879] [368106] (3 PDB entries)
  8. 2899303Domain d6g9va_: 6g9v A: [368139]
    automated match to d4bmaa_
    complexed with mg, ppv, ud1

Details for d6g9va_

PDB Entry: 6g9v (more details), 1.75 Å

PDB Description: crystal structure of aspergillus fumigatus udp-n-acetylglucosamine pyrophosphorylase(afuap1) in complex with udpglcnac, pyrophosphate and mg2+
PDB Compounds: (A:) udp-n-acetylglucosamine pyrophosphorylase

SCOPe Domain Sequences for d6g9va_:

Sequence, based on SEQRES records: (download)

>d6g9va_ c.68.1.0 (A:) automated matches {Aspergillus fumigatus [TaxId: 330879]}
psaeefqqlrkkytdagqghvfafvdelqtgersqlfhqlssfdpvrineladkalnppk
addgpasleplpdiatasildsdpkdleqwyeeglklvagnkvavvlmaggqgtrlgssa
pkgcfdiglpshkslfqiqaeriaklqllaqrisgkeavipwyvmtsgptrkpteeffeq
hkyfglnksdviifeqgvlpcisnegkilmeskfkvavapdgnggiyqalltsgvredmr
krgiehihtycvdnclvkvadpvfigfaaskqvdiatkvvrkrnatesvglilqkngkpd
vveyseidketaeakdpkqpdvlkfraanivnhyysfkffesielwahklphhvarkkip
cikegtgeffkpekpngikleqfvfdvfpmtplekfacievrredefsplknargtgedd
pdtskrdimsqgqrwiekaggivitegdvvgvevsplisyggegleflkgreikapafie
k

Sequence, based on observed residues (ATOM records): (download)

>d6g9va_ c.68.1.0 (A:) automated matches {Aspergillus fumigatus [TaxId: 330879]}
psaeefqqlrkkytdagqghvfafvdelqtgersqlfhqlssfdpvrineladkalnppa
sleplpdiatasildsdpkdleqwyeeglklvagnkvavvlmaggqgtrlgssapkgcfd
iglpshkslfqiqaeriaklqllaqrisgkeavipwyvmtsgptrkpteeffeqhkyfgl
nksdviifeqgvlpcisnegkilmeskfkvavapdgnggiyqalltsgvredmrkrgieh
ihtycvdnclvkvadpvfigfaaskqvdiatkvvrkrnatesvglilqkngkpdvveyse
idketaeakdpkqpdvlkfraanivnhyysfkffesielwahklphhvarkkipcipngi
kleqfvfdvfpmtplekfacievrredefsplknargtgeddpdtskrdimsqgqrwiek
aggivitegvgvevsplisyggegleflkgreikapafiek

SCOPe Domain Coordinates for d6g9va_:

Click to download the PDB-style file with coordinates for d6g9va_.
(The format of our PDB-style files is described here.)

Timeline for d6g9va_: