PDB entry 6g5t

View 6g5t on RCSB PDB site
Description: Myoglobin H64V/V68A in the resting state, 1.5 Angstrom resolution
Class: oxygen storage
Keywords: Myoglobin, Heme, N-methylhistidine, OXYGEN STORAGE
Deposited on 2018-03-30, released 2018-08-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-22, with a file datestamp of 2018-08-17.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon [TaxId:9755]
    Gene: MB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02185 (0-153)
      • engineered mutation (64)
      • engineered mutation (68)
      • expression tag (154)
    Domains in SCOPe 2.07: d6g5ta1, d6g5ta2
  • Heterogens: HEM, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6g5tA (A:)
mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
dlkkvgvtaltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgdfgadaqgamnkalelfrkdiaakykelgyqggsghhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >6g5tA (A:)
mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
dlkkvgvtaltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgdfgadaqgamnkalelfrkdiaakykelgyqgg