PDB entry 6fkf

View 6fkf on RCSB PDB site
Description: Chloroplast F1Fo conformation 1
Class: membrane protein
Keywords: ATP synthase, membrane protein complex, molecular motor, MEMBRANE PROTEIN
Deposited on 2018-01-24, released 2018-05-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-23, with a file datestamp of 2018-05-18.
Experiment type: EM
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP synthase subunit alpha, chloroplastic
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fkfa1, d6fkfa2, d6fkfa3
  • Chain 'B':
    Compound: ATP synthase subunit beta, chloroplastic
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fkfb1, d6fkfb2, d6fkfb3
  • Chain 'C':
    Compound: ATP synthase subunit alpha, chloroplastic
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fkfc1, d6fkfc2, d6fkfc3
  • Chain 'D':
    Compound: ATP synthase subunit beta, chloroplastic
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fkfd1, d6fkfd2, d6fkfd3
  • Chain 'E':
    Compound: ATP synthase subunit alpha, chloroplastic
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fkfe1, d6fkfe2, d6fkfe3
  • Chain 'F':
    Compound: ATP synthase subunit beta, chloroplastic
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fkff1, d6fkff2, d6fkff3
  • Chain 'G':
    Compound: ATP synthase subunit c, chloroplastic
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: ATP synthase subunit c, chloroplastic
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: ATP synthase subunit c, chloroplastic
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: ATP synthase subunit c, chloroplastic
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: ATP synthase subunit c, chloroplastic
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: ATP synthase subunit c, chloroplastic
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: ATP synthase subunit c, chloroplastic
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: ATP synthase subunit c, chloroplastic
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'O':
    Compound: ATP synthase subunit c, chloroplastic
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'P':
    Compound: ATP synthase subunit c, chloroplastic
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Q':
    Compound: ATP synthase subunit c, chloroplastic
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'R':
    Compound: ATP synthase subunit c, chloroplastic
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'S':
    Compound: ATP synthase subunit c, chloroplastic
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'T':
    Compound: ATP synthase subunit c, chloroplastic
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'a':
    Compound: ATP synthase subunit a, chloroplastic
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'b':
    Compound: ATP synthase subunit b, chloroplastic
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'd':
    Compound: ATP synthase delta chain, chloroplastic
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'e':
    Compound: ATP synthase epsilon chain, chloroplastic
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'g':
    Compound: ATP synthase gamma chain, chloroplastic
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'p':
    Compound: ATP synthase subunit b', chloroplastic
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ATP, MG, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fkfA (A:)
    matiradeiskiireriegynrevkvvntgtvlqvgdgiarihgldevmagelvefeegt
    igialnlesnnvgvvlmgdglmiqegssvkatgriaqipvseaylgrvinalakpidgrg
    eitasesrliespapgimsrrsvyeplqtgliaidamipvgrgqreliigdrqtgktava
    tdtilnqqgqnvicvyvaigqkassvaqvvtnfqergameytivvaetadspatlqylap
    ytgaalaeyfmyrerhtliiyddlskqaqayrqmslllrrppgreaypgdvfylhsrlle
    raaklssllgegsmtalpivetqagdvsayiptnvisitdgqiflsadlfnagirpainv
    gisvsrvgsaaqikamkkvagklklelaqfaeleafaqfasdldkatqnqlargqrlrel
    lkqpqsapltveeqvmtiytgtngyldsleldqvrkylvelrtyvktnkpefqeiisstk
    tfteeaeallkeaiqeqmerfllqeqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fkfA (A:)
    tiradeiskiireriegynrevkvvntgtvlqvgdgiarihgldevmagelvefeegtig
    ialnlesnnvgvvlmgdglmiqegssvkatgriaqipvseaylgrvinalakpidgrgei
    tasesrliespapgimsrrsvyeplqtgliaidamipvgrgqreliigdrqtgktavatd
    tilnqqgqnvicvyvaigqkassvaqvvtnfqergameytivvaetadspatlqylapyt
    gaalaeyfmyrerhtliiyddlskqaqayrqmslllrrppgreaypgdvfylhsrllera
    aklssllgegsmtalpivetqagdvsayiptnvisitdgqiflsadlfnagirpainvgi
    svsrvgsaaqikamkkvagklklelaqfaeleafaqfasdldkatqnqlargqrlrellk
    qpqsapltveeqvmtiytgtngyldsleldqvrkylvelrtyvktnkpefqeiisstktf
    teeaeallkeaiqeqmerfllq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6fkfB (B:)
    mrinpttsdpgvstlekknlgriaqiigpvldvafppgkmpniynalivkgrdtagqpmn
    vtcevqqllgnnrvravamsatdgltrgmevidtgaplsvpvggatlgrifnvlgepvdn
    lgpvdtrttspihrsapaftqldtklsifetgikvvdllapyrrggkiglfggagvgktv
    limelinniakahggvsvfggvgertregndlymemkesgvineqniaeskvalvygqmn
    eppgarmrvgltaltmaeyfrdvneqdvllfidnifrfvqagsevsallgrmpsavgyqp
    tlstemgslqeritstkegsitsiqavyvpaddltdpapattfahldattvlsrglaakg
    iypavdpldststmlqprivgeehyeiaqrvketlqrykelqdiiailgldelseedrlt
    vararkierflsqpffvaevftgspgkyvglaetirgfqlilsgeldslpeqafylvgni
    deatakamnlemesklkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fkfB (B:)
    knlgriaqiigpvldvafppgkmpniynalivkgrdtagqpmnvtcevqqllgnnrvrav
    amsatdgltrgmevidtgaplsvpvggatlgrifnvlgepvdnlgpvdtrttspihrsap
    aftqldtklsifetgikvvdllapyrrggkiglfggagvgktvlimelinniakahggvs
    vfggvgertregndlymemkesgvineqniaeskvalvygqmneppgarmrvgltaltma
    eyfrdvneqdvllfidnifrfvqagsevsallgrmpsavgyqptlstemgslqeritstk
    egsitsiqavyvpaddltdpapattfahldattvlsrglaakgiypavdpldststmlqp
    rivgeehyeiaqrvketlqrykelqdiiailgldelseedrltvararkierflsqpffv
    aevftgspgkyvglaetirgfqlilsgeldslpeqafylvgnideatakamnlemeskl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6fkfC (C:)
    matiradeiskiireriegynrevkvvntgtvlqvgdgiarihgldevmagelvefeegt
    igialnlesnnvgvvlmgdglmiqegssvkatgriaqipvseaylgrvinalakpidgrg
    eitasesrliespapgimsrrsvyeplqtgliaidamipvgrgqreliigdrqtgktava
    tdtilnqqgqnvicvyvaigqkassvaqvvtnfqergameytivvaetadspatlqylap
    ytgaalaeyfmyrerhtliiyddlskqaqayrqmslllrrppgreaypgdvfylhsrlle
    raaklssllgegsmtalpivetqagdvsayiptnvisitdgqiflsadlfnagirpainv
    gisvsrvgsaaqikamkkvagklklelaqfaeleafaqfasdldkatqnqlargqrlrel
    lkqpqsapltveeqvmtiytgtngyldsleldqvrkylvelrtyvktnkpefqeiisstk
    tfteeaeallkeaiqeqmerfllqeqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fkfC (C:)
    radeiskiireriegynrevkvvntgtvlqvgdgiarihgldevmagelvefeegtigia
    lnlesnnvgvvlmgdglmiqegssvkatgriaqipvseaylgrvinalakpidgrgeita
    sesrliespapgimsrrsvyeplqtgliaidamipvgrgqreliigdrqtgktavatdti
    lnqqgqnvicvyvaigqkassvaqvvtnfqergameytivvaetadspatlqylapytga
    alaeyfmyrerhtliiyddlskqaqayrqmslllrrppgreaypgdvfylhsrlleraak
    lssllgegsmtalpivetqagdvsayiptnvisitdgqiflsadlfnagirpainvgisv
    srvgsaaqikamkkvagklklelaqfaeleafaqfasdldkatqnqlargqrlrellkqp
    qsapltveeqvmtiytgtngyldsleldqvrkylvelrtyvktnkpefqeiisstktfte
    eaeallkeaiqeqmerfll
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6fkfD (D:)
    mrinpttsdpgvstlekknlgriaqiigpvldvafppgkmpniynalivkgrdtagqpmn
    vtcevqqllgnnrvravamsatdgltrgmevidtgaplsvpvggatlgrifnvlgepvdn
    lgpvdtrttspihrsapaftqldtklsifetgikvvdllapyrrggkiglfggagvgktv
    limelinniakahggvsvfggvgertregndlymemkesgvineqniaeskvalvygqmn
    eppgarmrvgltaltmaeyfrdvneqdvllfidnifrfvqagsevsallgrmpsavgyqp
    tlstemgslqeritstkegsitsiqavyvpaddltdpapattfahldattvlsrglaakg
    iypavdpldststmlqprivgeehyeiaqrvketlqrykelqdiiailgldelseedrlt
    vararkierflsqpffvaevftgspgkyvglaetirgfqlilsgeldslpeqafylvgni
    deatakamnlemesklkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fkfD (D:)
    kknlgriaqiigpvldvafppgkmpniynalivkgrdtagqpmnvtcevqqllgnnrvra
    vamsatdgltrgmevidtgaplsvpvggatlgrifnvlgepvdnlgpvdtrttspihrsa
    paftqldtklsifetgikvvdllapyrrggkiglfggagvgktvlimelinniakahggv
    svfggvgertregndlymemkesgvineqniaeskvalvygqmneppgarmrvgltaltm
    aeyfrdvneqdvllfidnifrfvqagsevsallgrmpsavgyqptlstemgslqeritst
    kegsitsiqavyvpaddltdpapattfahldattvlsrglaakgiypavdpldststmlq
    privgeehyeiaqrvketlqrykelqdiiailgldelseedrltvararkierflsqpff
    vaevftgspgkyvglaetirgfqlilsgeldslpeqafylvgnideatakamnlemes
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6fkfE (E:)
    matiradeiskiireriegynrevkvvntgtvlqvgdgiarihgldevmagelvefeegt
    igialnlesnnvgvvlmgdglmiqegssvkatgriaqipvseaylgrvinalakpidgrg
    eitasesrliespapgimsrrsvyeplqtgliaidamipvgrgqreliigdrqtgktava
    tdtilnqqgqnvicvyvaigqkassvaqvvtnfqergameytivvaetadspatlqylap
    ytgaalaeyfmyrerhtliiyddlskqaqayrqmslllrrppgreaypgdvfylhsrlle
    raaklssllgegsmtalpivetqagdvsayiptnvisitdgqiflsadlfnagirpainv
    gisvsrvgsaaqikamkkvagklklelaqfaeleafaqfasdldkatqnqlargqrlrel
    lkqpqsapltveeqvmtiytgtngyldsleldqvrkylvelrtyvktnkpefqeiisstk
    tfteeaeallkeaiqeqmerfllqeqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fkfE (E:)
    eiskiireriegynrevkvvntgtvlqvgdgiarihgldevmagelvefeegtigialnl
    esnnvgvvlmgdglmiqegssvkatgriaqipvseaylgrvinalakpidgrgeitases
    rliespapgimsrrsvyeplqtgliaidamipvgrgqreliigdrqtgktavatdtilnq
    qgqnvicvyvaigqkassvaqvvtnfqergameytivvaetadspatlqylapytgaala
    eyfmyrerhtliiyddlskqaqayrqmslllrrppgreaypgdvfylhsrlleraaklss
    llgegsmtalpivetqagdvsayiptnvisitdgqiflsadlfnagirpainvgisvsrv
    gsaaqikamkkvagklklelaqfaeleafaqfasdldkatqnqlargqrlrellkqpqsa
    pltveeqvmtiytgtngyldsleldqvrkylvelrtyvktnkpefqeiisstktfteeae
    allkeaiqeqmerfllq
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6fkfF (F:)
    mrinpttsdpgvstlekknlgriaqiigpvldvafppgkmpniynalivkgrdtagqpmn
    vtcevqqllgnnrvravamsatdgltrgmevidtgaplsvpvggatlgrifnvlgepvdn
    lgpvdtrttspihrsapaftqldtklsifetgikvvdllapyrrggkiglfggagvgktv
    limelinniakahggvsvfggvgertregndlymemkesgvineqniaeskvalvygqmn
    eppgarmrvgltaltmaeyfrdvneqdvllfidnifrfvqagsevsallgrmpsavgyqp
    tlstemgslqeritstkegsitsiqavyvpaddltdpapattfahldattvlsrglaakg
    iypavdpldststmlqprivgeehyeiaqrvketlqrykelqdiiailgldelseedrlt
    vararkierflsqpffvaevftgspgkyvglaetirgfqlilsgeldslpeqafylvgni
    deatakamnlemesklkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fkfF (F:)
    kknlgriaqiigpvldvafppgkmpniynalivkgrdtagqpmnvtcevqqllgnnrvra
    vamsatdgltrgmevidtgaplsvpvggatlgrifnvlgepvdnlgpvdtrttspihrsa
    paftqldtklsifetgikvvdllapyrrggkiglfggagvgktvlimelinniakahggv
    svfggvgertregndlymemkesgvineqniaeskvalvygqmneppgarmrvgltaltm
    aeyfrdvneqdvllfidnifrfvqagsevsallgrmpsavgyqptlstemgslqeritst
    kegsitsiqavyvpaddltdpapattfahldattvlsrglaakgiypavdpldststmlq
    privgeehyeiaqrvketlqrykelqdiiailgldelseedrltvararkierflsqpff
    vaevftgspgkyvglaetirgfqlilsgeldslpeqafylvgnideatakamnlemeskl
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    No sequence available.

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.

  • Chain 'R':
    No sequence available.

  • Chain 'S':
    No sequence available.

  • Chain 'T':
    No sequence available.

  • Chain 'a':
    No sequence available.

  • Chain 'b':
    No sequence available.

  • Chain 'd':
    No sequence available.

  • Chain 'e':
    No sequence available.

  • Chain 'g':
    No sequence available.

  • Chain 'p':
    No sequence available.