Lineage for d6fkfd3 (6fkf D:378-494)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717308Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 2717309Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families) (S)
  5. 2717538Family a.69.1.0: automated matches [254233] (1 protein)
    not a true family
  6. 2717539Protein automated matches [254528] (17 species)
    not a true protein
  7. 2717675Species Spinach (Spinacia oleracea) [TaxId:3562] [352455] (2 PDB entries)
  8. 2717685Domain d6fkfd3: 6fkf D:378-494 [352476]
    Other proteins in same PDB: d6fkfa1, d6fkfa2, d6fkfb1, d6fkfb2, d6fkfc1, d6fkfc2, d6fkfd1, d6fkfd2, d6fkfe1, d6fkfe2, d6fkff1, d6fkff2
    automated match to d2qe7d3
    complexed with adp, atp, mg

Details for d6fkfd3

PDB Entry: 6fkf (more details), 3.1 Å

PDB Description: chloroplast f1fo conformation 1
PDB Compounds: (D:) ATP synthase subunit beta, chloroplastic

SCOPe Domain Sequences for d6fkfd3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fkfd3 a.69.1.0 (D:378-494) automated matches {Spinach (Spinacia oleracea) [TaxId: 3562]}
rivgeehyeiaqrvketlqrykelqdiiailgldelseedrltvararkierflsqpffv
aevftgspgkyvglaetirgfqlilsgeldslpeqafylvgnideatakamnlemes

SCOPe Domain Coordinates for d6fkfd3:

Click to download the PDB-style file with coordinates for d6fkfd3.
(The format of our PDB-style files is described here.)

Timeline for d6fkfd3: