Class a: All alpha proteins [46456] (290 folds) |
Fold a.69: Left-handed superhelix [47916] (4 superfamilies) core: 4-5 helices; bundle; left-handed superhelix |
Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families) |
Family a.69.1.0: automated matches [254233] (1 protein) not a true family |
Protein automated matches [254528] (17 species) not a true protein |
Species Spinach (Spinacia oleracea) [TaxId:3562] [352455] (2 PDB entries) |
Domain d6fkfd3: 6fkf D:378-494 [352476] Other proteins in same PDB: d6fkfa1, d6fkfa2, d6fkfb1, d6fkfb2, d6fkfc1, d6fkfc2, d6fkfd1, d6fkfd2, d6fkfe1, d6fkfe2, d6fkff1, d6fkff2 automated match to d2qe7d3 complexed with adp, atp, mg |
PDB Entry: 6fkf (more details), 3.1 Å
SCOPe Domain Sequences for d6fkfd3:
Sequence; same for both SEQRES and ATOM records: (download)
>d6fkfd3 a.69.1.0 (D:378-494) automated matches {Spinach (Spinacia oleracea) [TaxId: 3562]} rivgeehyeiaqrvketlqrykelqdiiailgldelseedrltvararkierflsqpffv aevftgspgkyvglaetirgfqlilsgeldslpeqafylvgnideatakamnlemes
Timeline for d6fkfd3: