PDB entry 6fet

View 6fet on RCSB PDB site
Description: Crystal structure of human phosphodiesterase 4D2 catalytic domain with inhibitor NPD-1439
Class: hydrolase
Keywords: phosphodiesterase, hydrolase, cAMP hydrolysis, alternative splicing
Deposited on 2018-01-03, released 2019-04-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-24, with a file datestamp of 2019-04-19.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4D
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE4D, DPDE3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6feta_
  • Chain 'B':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4D
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE4D, DPDE3
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4D
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE4D, DPDE3
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4D
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE4D, DPDE3
    Database cross-references and differences (RAF-indexed):
  • Heterogens: D68, ZN, MG, EDO, PEG, EPE, NI, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fetA (A:)
    gshmiprfgvkteqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllkt
    fkipvdtlitylmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaai
    fasaihdvdhpgvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltk
    kqrqslrkmvidivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmv
    hcadlsnptkplqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfid
    yivhplwetwadlvhpdaqdildtlednrewyqstipqspspapddpeegrqgqtekfqf
    eltl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fetA (A:)
    gvkteqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtl
    itylmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdv
    dhpgvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrk
    mvidivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnp
    tkplqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwe
    twadlvhpdaqdildtlednrewyqstip
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.