Lineage for d6feta_ (6fet A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2342123Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2342124Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 2342214Family a.211.1.2: PDEase [48548] (7 proteins)
    Pfam PF00233; multihelical; can be divided into three subdomains
  6. 2342277Protein Catalytic domain of cyclic nucleotide phosphodiesterase pde4d [89151] (1 species)
  7. 2342278Species Human (Homo sapiens) [TaxId:9606] [89152] (53 PDB entries)
    Uniprot Q08499 388-713
  8. 3067981Domain d6feta_: 6fet A: [368043]
    automated match to d3g58d_
    complexed with d68, edo, epe, mg, ni, peg, pg4, zn

Details for d6feta_

PDB Entry: 6fet (more details), 1.88 Å

PDB Description: crystal structure of human phosphodiesterase 4d2 catalytic domain with inhibitor npd-1439
PDB Compounds: (A:) cAMP-specific 3',5'-cyclic phosphodiesterase 4D

SCOPe Domain Sequences for d6feta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6feta_ a.211.1.2 (A:) Catalytic domain of cyclic nucleotide phosphodiesterase pde4d {Human (Homo sapiens) [TaxId: 9606]}
gvkteqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtl
itylmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdv
dhpgvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrk
mvidivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnp
tkplqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwe
twadlvhpdaqdildtlednrewyqstip

SCOPe Domain Coordinates for d6feta_:

Click to download the PDB-style file with coordinates for d6feta_.
(The format of our PDB-style files is described here.)

Timeline for d6feta_:

  • d6feta_ appears in periodic updates to SCOPe 2.07 starting on 2019-04-25