PDB entry 6f8s

View 6f8s on RCSB PDB site
Description: Toxin-Antitoxin complex GraTA
Class: toxin
Keywords: GraA, GraT, HigA, HigB, GraTA, HigBA, toxin
Deposited on 2017-12-13, released 2018-07-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-03-13, with a file datestamp of 2019-03-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: XRE family transcriptional regulator
  Species: Pseudomonas putida [TaxId:303]
  Gene: AYO08_18510
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0A179R2V1 (Start-98)
  Domains in SCOPe 2.08: d6f8sa_
• Chain 'B':
  Compound: Putative Killer protein
  Species: Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440) [TaxId:160488]
  Gene: PP_1586
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q88MI5 (Start-97)
• Chain 'C':
  Compound: XRE family transcriptional regulator
  Species: Pseudomonas putida [TaxId:303]
  Gene: AYO08_18510
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0A179R2V1 (Start-98)
  Domains in SCOPe 2.08: d6f8sc_
• Chain 'D':
  Compound: Putative Killer protein
  Species: Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440) [TaxId:160488]
  Gene: PP_1586
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q88MI5 (Start-97)
• Heterogens: SO4, PEG, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >6f8sA (A:)
  mlkngmrpihpgeilreefqkemgfsaaalaralgvatptvnnilrerggvsadmalrls
  icldttpefwlnlqtafdlrtaeqqhgdeiigsvqrlva
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >6f8sA (A:)
  mrpihpgeilreefqkemgfsaaalaralgvatptvnnilrerggvsadmalrlsicldt
  tpefwlnlqtafdlrtaeqqhgdeiigsvqrlva
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  Sequence, based on SEQRES records: (download)
  

  >6f8sC (C:)
  mlkngmrpihpgeilreefqkemgfsaaalaralgvatptvnnilrerggvsadmalrls
  icldttpefwlnlqtafdlrtaeqqhgdeiigsvqrlva
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >6f8sC (C:)
  gmrpihpgeilreefqkemgfsaaalaralgvatptvnnilrerggvsadmalrlsicld
  ttpefwlnlqtafdlrtaeqqhgdeiigsvqrlva
  

  
  
• Chain 'D':
  No sequence available.