PDB entry 6f8s

View 6f8s on RCSB PDB site
Description: Toxin-Antitoxin complex GraTA
Class: toxin
Keywords: GraA, GraT, HigA, HigB, GraTA, HigBA, toxin
Deposited on 2017-12-13, released 2018-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-11, with a file datestamp of 2018-07-06.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: XRE family transcriptional regulator
    Species: Pseudomonas putida [TaxId:303]
    Gene: AYO08_18510
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6f8sa_
  • Chain 'B':
    Compound: Putative Killer protein
    Species: Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440) [TaxId:160488]
    Gene: PP_1586
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: XRE family transcriptional regulator
    Species: Pseudomonas putida [TaxId:303]
    Gene: AYO08_18510
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6f8sc_
  • Chain 'D':
    Compound: Putative Killer protein
    Species: Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440) [TaxId:160488]
    Gene: PP_1586
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6f8sA (A:)
    mlkngmrpihpgeilreefqkemgfsaaalaralgvatptvnnilrerggvsadmalrls
    icldttpefwlnlqtafdlrtaeqqhgdeiigsvqrlva
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f8sA (A:)
    mrpihpgeilreefqkemgfsaaalaralgvatptvnnilrerggvsadmalrlsicldt
    tpefwlnlqtafdlrtaeqqhgdeiigsvqrlva
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6f8sC (C:)
    mlkngmrpihpgeilreefqkemgfsaaalaralgvatptvnnilrerggvsadmalrls
    icldttpefwlnlqtafdlrtaeqqhgdeiigsvqrlva
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f8sC (C:)
    gmrpihpgeilreefqkemgfsaaalaralgvatptvnnilrerggvsadmalrlsicld
    ttpefwlnlqtafdlrtaeqqhgdeiigsvqrlva
    

  • Chain 'D':
    No sequence available.