SCOPe 2.08: Domain d6f8sc_: 6f8s C:

Lineage for d6f8sc_ (6f8s C:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.0: automated matches [191534] (1 protein)
   not a true family

6. Protein automated matches [190907] (21 species)
   not a true protein

7. Species Pseudomonas putida [TaxId:303] [354513] (2 PDB entries)

8. Domain d6f8sc_: 6f8s C: [354514]
   automated match to d4mcxc_
   complexed with peg, so4

Details for d6f8sc_

PDB Entry: 6f8s, 2.5 Å

PDB Description: toxin-antitoxin complex grata

PDB Compounds: (C:) XRE family transcriptional regulator

SCOPe Domain Sequences for d6f8sc_:

Sequence; same for both SEQRES and ATOM records:

>d6f8sc_ a.35.1.0 (C:) automated matches {Pseudomonas putida [TaxId: 303]}
gmrpihpgeilreefqkemgfsaaalaralgvatptvnnilrerggvsadmalrlsicld
ttpefwlnlqtafdlrtaeqqhgdeiigsvqrlva

Timeline for d6f8sc_:

• d6f8sc_ first appeared in SCOPe 2.07